PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000294G0540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 255aa    MW: 28061.4 Da    PI: 4.9867
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000294G0540genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind78.51.1e-2460119261
                      HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
     HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                      Fl+k+y++++d+ +++++sw e++++fvv+ + efa+++Lp+yFkh+nf+SFvRQLn+Y 
  PH01000294G0540  60 FLTKTYQLVDDPCTDHVVSWGEDETTFVVWRPPEFARDLLPNYFKHNNFSSFVRQLNTYP 119
                      9*********************************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.6E-2652118IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.3E-2656153IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.2E-2259129IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004474.6E-2160130IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.7E-156083IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.7E-1598110IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.7E-15111123IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MAARTSIVMF LVHGAVAGLF TGAPYTSAQR GQMAFLVERC SGEMVVSMEG SHAKPVPAPF  60
LTKTYQLVDD PCTDHVVSWG EDETTFVVWR PPEFARDLLP NYFKHNNFSS FVRQLNTYPP  120
PPVYHFQEDS AADSGGGDFL AALSEDNQQL RRRNSLLLSE LAHMRKLYND IIYFLQNHVE  180
PVPPPTPTPP ASCRLVELSP AECGASPQLR QRGDDTAVKL FGVRLNEGKK RRAQLEEGDG  240
DHGDGDGDDQ GSEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B6e-16561282697Heat shock factor protein 1
5d5v_B6e-16561282697Heat shock factor protein 1
5d5v_D6e-16561282697Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0541483e-73BT054148.1 Zea mays full-length cDNA clone ZM_BFb0133K13 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003561606.15e-89PREDICTED: heat stress transcription factor B-4d-like
SwissprotQ7XHZ07e-50HFB4B_ORYSJ; Heat stress transcription factor B-4b
TrEMBLA0A0Q3LF326e-89A0A0Q3LF32_BRADI; Uncharacterized protein
STRINGBRADI1G61620.13e-80(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46264.11e-40heat shock transcription factor B4